Lineage for d1mz8a_ (1mz8 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280342Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 280376Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
  5. 280377Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins)
  6. 280378Protein ImmE7 protein (Im7) [47347] (1 species)
  7. 280379Species Escherichia coli [TaxId:562] [47348] (5 PDB entries)
  8. 280386Domain d1mz8a_: 1mz8 A: [79683]
    Other proteins in same PDB: d1mz8b_, d1mz8d_

Details for d1mz8a_

PDB Entry: 1mz8 (more details), 2 Å

PDB Description: crystal structures of the nuclease domain of cole7/im7 in complex with a phosphate ion and a zinc ion

SCOP Domain Sequences for d1mz8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mz8a_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli}
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

SCOP Domain Coordinates for d1mz8a_:

Click to download the PDB-style file with coordinates for d1mz8a_.
(The format of our PDB-style files is described here.)

Timeline for d1mz8a_: