Lineage for d1mz6a2 (1mz6 A:1-403)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326286Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1326287Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1326288Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1326520Protein Trypanosoma sialidase [82164] (2 species)
  7. 1326541Species Trypanosoma rangeli [TaxId:5698] [82165] (10 PDB entries)
    Uniprot O44049 20-653
  8. 1326551Domain d1mz6a2: 1mz6 A:1-403 [79682]
    Other proteins in same PDB: d1mz6a1
    complexed with dan, nag

Details for d1mz6a2

PDB Entry: 1mz6 (more details), 2.9 Å

PDB Description: trypanosoma rangeli sialidase in complex with the inhibitor dana
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1mz6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mz6a2 b.68.1.1 (A:1-403) Trypanosoma sialidase {Trypanosoma rangeli [TaxId: 5698]}
lapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvatadaryetsfd
nsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktrns
wtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefvggv
gaaivgsngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlewegk
liinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegkrv
mlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhein
tndvyslvfvrfigelqlmksvvrtwkeednhlasictpvvpa

SCOPe Domain Coordinates for d1mz6a2:

Click to download the PDB-style file with coordinates for d1mz6a2.
(The format of our PDB-style files is described here.)

Timeline for d1mz6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mz6a1