Lineage for d1mz6a1 (1mz6 A:411-630)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043944Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)
  6. 2043945Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)
  7. 2043967Species Trypanosoma rangeli [TaxId:5698] [82040] (7 PDB entries)
    Uniprot O44049 20-653
  8. 2043974Domain d1mz6a1: 1mz6 A:411-630 [79681]
    Other proteins in same PDB: d1mz6a2
    complexed with dan, nag

Details for d1mz6a1

PDB Entry: 1mz6 (more details), 2.9 Å

PDB Description: Trypanosoma rangeli sialidase in complex with the inhibitor DANA
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1mz6a1:

Sequence, based on SEQRES records: (download)

>d1mz6a1 b.29.1.15 (A:411-630) Trypanosoma sialidase, C-terminal domain {Trypanosoma rangeli [TaxId: 5698]}
cgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarq
gqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplyg
aapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggp
rskgaptdsrvtvtnivlynrrlnsseirtlflsqdmigt

Sequence, based on observed residues (ATOM records): (download)

>d1mz6a1 b.29.1.15 (A:411-630) Trypanosoma sialidase, C-terminal domain {Trypanosoma rangeli [TaxId: 5698]}
cgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarq
gqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwrplyg
aapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggp
gaptdsrvtvtnivlynrrlnsseirtlflsqdmigt

SCOPe Domain Coordinates for d1mz6a1:

Click to download the PDB-style file with coordinates for d1mz6a1.
(The format of our PDB-style files is described here.)

Timeline for d1mz6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mz6a2