Lineage for d1mz5a2 (1mz5 A:1-403)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 233193Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 233194Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 233195Family b.68.1.1: Sialidases (neuraminidases) [50940] (7 proteins)
  6. 233294Protein Trypanosoma rangeli sialidase [82164] (1 species)
  7. 233295Species Trypanosoma rangeli [TaxId:5698] [82165] (6 PDB entries)
  8. 233299Domain d1mz5a2: 1mz5 A:1-403 [79680]
    Other proteins in same PDB: d1mz5a1
    complexed with nag

Details for d1mz5a2

PDB Entry: 1mz5 (more details), 2.2 Å

PDB Description: trypanosoma rangeli sialidase

SCOP Domain Sequences for d1mz5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mz5a2 b.68.1.1 (A:1-403) Trypanosoma rangeli sialidase {Trypanosoma rangeli}
lapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvatadaryetsfd
nsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktrns
wtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefvggv
gaaivgsngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlewegk
liinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegkrv
mlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhein
tndvyslvfvrfigelqlmksvvrtwkeednhlasictpvvpa

SCOP Domain Coordinates for d1mz5a2:

Click to download the PDB-style file with coordinates for d1mz5a2.
(The format of our PDB-style files is described here.)

Timeline for d1mz5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mz5a1