SCOPe 2.05: Domain d1mywa_: 1myw A:

Lineage for d1mywa_ (1myw A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (167 PDB entries)
   Uniprot P42212

8. Domain d1mywa_: 1myw A: [79678]
   yellow-emission variant

Details for d1mywa_

PDB Entry: 1myw, 2.2 Å

PDB Description: crystal structure of a yellow fluorescent protein with improved maturation and reduced environmental sensitivity

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d1mywa_:

Sequence; same for both SEQRES and ATOM records:

>d1mywa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlklicttgklpvpwpt
lvttlgyglqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtl
vnrielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedggvqla
dhyqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagit

Timeline for d1mywa_:

• d1mywa_ first appeared in SCOP 1.63
  
• d1mywa_ appears in SCOPe 2.04
  
• d1mywa_ is called d1mywa1 in SCOPe 2.06
  
• d1mywa_ appears in the current release, SCOPe 2.08, called d1mywa1