Lineage for d1my5b_ (1my5 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375024Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2375071Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)
  7. 2375078Species Mouse (Mus musculus) [TaxId:10090] [49254] (13 PDB entries)
  8. 2375082Domain d1my5b_: 1my5 B: [79674]

Details for d1my5b_

PDB Entry: 1my5 (more details), 1.8 Å

PDB Description: NF-kappaB p65 subunit dimerization domain homodimer
PDB Compounds: (B:) NF-kappaB p65 (RelA) subunit

SCOPe Domain Sequences for d1my5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1my5b_ b.1.18.1 (B:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
taelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai
vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

SCOPe Domain Coordinates for d1my5b_:

Click to download the PDB-style file with coordinates for d1my5b_.
(The format of our PDB-style files is described here.)

Timeline for d1my5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1my5a_