SCOPe 2.05: Domain d1mxta2: 1mxt A:319-450

Lineage for d1mxta2 (1mxt A:319-450)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)

6. Protein Cholesterol oxidase [54375] (3 species)

7. Species Streptomyces sp. [TaxId:1931] [54377] (14 PDB entries)

8. Domain d1mxta2: 1mxt A:319-450 [79672]
   Other proteins in same PDB: d1mxta1
   atomic resolution structure
   complexed with fae, oxy, so4

Details for d1mxta2

PDB Entry: 1mxt, 0.95 Å

PDB Description: Atomic resolution structure of Cholesterol oxidase (Streptomyces sp. SA-COO)

PDB Compounds: (A:) cholesterol oxidase

SCOPe Domain Sequences for d1mxta2:

Sequence; same for both SEQRES and ATOM records:

>d1mxta2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp. [TaxId: 1931]}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyhplg

Timeline for d1mxta2:

• d1mxta2 first appeared in SCOP 1.63
  
• d1mxta2 appears in SCOPe 2.04
  
• d1mxta2 appears in SCOPe 2.06
  
• d1mxta2 appears in the current release, SCOPe 2.08