Class b: All beta proteins [48724] (119 folds) |
Fold b.38: Sm-like fold [50181] (2 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) |
Family b.38.1.3: Mechanosensitive channel protein MscS (YggB), middle domain [82090] (1 protein) |
Protein Mechanosensitive channel protein MscS (YggB), middle domain [82091] (1 species) forms homoheptameric ring structure very similar to those of the archaeal and eukaryotic Sm proteins |
Species Escherichia coli [TaxId:562] [82092] (1 PDB entry) |
Domain d1mxmg1: 1mxm G:113-179 [79665] Other proteins in same PDB: d1mxma2, d1mxma3, d1mxmb2, d1mxmb3, d1mxmc2, d1mxmc3, d1mxmd2, d1mxmd3, d1mxme2, d1mxme3, d1mxmf2, d1mxmf3, d1mxmg2, d1mxmg3 |
PDB Entry: 1mxm (more details), 3.9 Å
SCOP Domain Sequences for d1mxmg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mxmg1 b.38.1.3 (G:113-179) Mechanosensitive channel protein MscS (YggB), middle domain {Escherichia coli} gslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiia gniinfs
Timeline for d1mxmg1: