Lineage for d1mxia_ (1mxi A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594975Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 594976Superfamily c.116.1: alpha/beta knot [75217] (5 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 594977Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (4 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546
  6. 594978Protein Hypothetical tRNA/rRNA methyltransfease HI0766 (YibK homologue) [82374] (1 species)
  7. 594979Species Haemophilus influenzae [TaxId:727] [82375] (2 PDB entries)
  8. 594980Domain d1mxia_: 1mxi A: [79646]
    complexed with iod, sah

Details for d1mxia_

PDB Entry: 1mxi (more details), 1.7 Å

PDB Description: Structure of YibK from Haemophilus influenzae (HI0766): a Methyltransferase with a Cofactor Bound at a Site Formed by a Knot

SCOP Domain Sequences for d1mxia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxia_ c.116.1.1 (A:) Hypothetical tRNA/rRNA methyltransfease HI0766 (YibK homologue) {Haemophilus influenzae}
mldivlyepeipqntgniirlcantgfrlhlieplgftwddkrlrrsgldyhefaeikrh
ktfeaflesekpkrlfalttkgcpahsqvkfklgdylmfgpetrgipmsilnempmeqki
ripmtansrsmnlsnsvavtvyeawrqlgykgavnl

SCOP Domain Coordinates for d1mxia_:

Click to download the PDB-style file with coordinates for d1mxia_.
(The format of our PDB-style files is described here.)

Timeline for d1mxia_: