Lineage for d1mxeb_ (1mxe B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914403Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 914454Protein Calmodulin [47516] (11 species)
  7. 914594Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47522] (9 PDB entries)
  8. 914596Domain d1mxeb_: 1mxe B: [79645]
    complex with the target sequence of Calmodulin-dependent protein kinase I (1a06), chains E and F
    complexed with ca

Details for d1mxeb_

PDB Entry: 1mxe (more details), 1.7 Å

PDB Description: Structure of the Complex of Calmodulin with the Target Sequence of CaMKI
PDB Compounds: (B:) calmodulin

SCOPe Domain Sequences for d1mxeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxeb_ a.39.1.5 (B:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
dfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevde
mireadidgdgqvnyeefvtmmts

SCOPe Domain Coordinates for d1mxeb_:

Click to download the PDB-style file with coordinates for d1mxeb_.
(The format of our PDB-style files is described here.)

Timeline for d1mxeb_: