Lineage for d1mxeb_ (1mxe B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213167Superfamily a.39.1: EF-hand [47473] (9 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 213324Family a.39.1.5: Calmodulin-like [47502] (17 proteins)
    Duplication: made with two pairs of EF-hands
  6. 213352Protein Calmodulin [47516] (7 species)
  7. 213392Species Drosophila melanogaster [TaxId:7227] [47522] (4 PDB entries)
  8. 213394Domain d1mxeb_: 1mxe B: [79645]
    complex with the target sequence of Calmodulin-dependent protein kinase I (1a06), chains E and F
    complexed with ca

Details for d1mxeb_

PDB Entry: 1mxe (more details), 1.7 Å

PDB Description: Structure of the Complex of Calmodulin with the Target Sequence of CaMKI

SCOP Domain Sequences for d1mxeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxeb_ a.39.1.5 (B:) Calmodulin {Drosophila melanogaster}
lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
dfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevde
mireadidgdgqvnyeefvtmmts

SCOP Domain Coordinates for d1mxeb_:

Click to download the PDB-style file with coordinates for d1mxeb_.
(The format of our PDB-style files is described here.)

Timeline for d1mxeb_: