Lineage for d1mxea_ (1mxe A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768689Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 768749Protein Calmodulin [47516] (11 species)
  7. 768841Species Drosophila melanogaster [TaxId:7227] [47522] (6 PDB entries)
  8. 768842Domain d1mxea_: 1mxe A: [79644]
    complex with the target sequence of Calmodulin-dependent protein kinase I (1a06), chains E and F

Details for d1mxea_

PDB Entry: 1mxe (more details), 1.7 Å

PDB Description: Structure of the Complex of Calmodulin with the Target Sequence of CaMKI
PDB Compounds: (A:) calmodulin

SCOP Domain Sequences for d1mxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxea_ a.39.1.5 (A:) Calmodulin {Drosophila melanogaster [TaxId: 7227]}
lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
dfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevde
mireadidgdgqvnyeefvtmmts

SCOP Domain Coordinates for d1mxea_:

Click to download the PDB-style file with coordinates for d1mxea_.
(The format of our PDB-style files is described here.)

Timeline for d1mxea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mxeb_