SCOP 1.63: Domain d1mxea_: 1mxe A:

Lineage for d1mxea_ (1mxe A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (9 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (17 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (7 species)

7. Species Drosophila melanogaster [TaxId:7227] [47522] (4 PDB entries)

8. Domain d1mxea_: 1mxe A: [79644]

Details for d1mxea_

PDB Entry: 1mxe, 1.7 Å

PDB Description: Structure of the Complex of Calmodulin with the Target Sequence of CaMKI

SCOP Domain Sequences for d1mxea_:

Sequence; same for both SEQRES and ATOM records:

>d1mxea_ a.39.1.5 (A:) Calmodulin {Drosophila melanogaster}
lteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
dfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevde
mireadidgdgqvnyeefvtmmts

Timeline for d1mxea_:

• d1mxea_ is new in SCOP 1.63
  
• d1mxea_ appears in SCOP 1.65
  
• d1mxea_ appears in the current release, SCOPe 2.08