Lineage for d1mx0e2 (1mx0 E:307-461)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499246Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 499247Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families) (S)
  5. 499309Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 499344Protein Topoisomerase VI-B subunit [82577] (1 species)
    contains an H2TH domain inserted in front of this domain and after the N-terminal ATPase domain
  7. 499345Species Archaeon Sulfolobus shibatae [TaxId:2286] [82578] (2 PDB entries)
  8. 499351Domain d1mx0e2: 1mx0 E:307-461 [79631]
    Other proteins in same PDB: d1mx0a1, d1mx0a3, d1mx0b1, d1mx0b3, d1mx0c1, d1mx0c3, d1mx0d1, d1mx0d3, d1mx0e1, d1mx0e3, d1mx0f1, d1mx0f3

Details for d1mx0e2

PDB Entry: 1mx0 (more details), 2.3 Å

PDB Description: Structure of topoisomerase subunit

SCOP Domain Sequences for d1mx0e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mx0e2 d.14.1.3 (E:307-461) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae}
rspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsipvge
epivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyksag
kesiaevediekeiknalmevarklkqylsekrke

SCOP Domain Coordinates for d1mx0e2:

Click to download the PDB-style file with coordinates for d1mx0e2.
(The format of our PDB-style files is described here.)

Timeline for d1mx0e2: