Lineage for d1mx0c3 (1mx0 C:4-228)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580324Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 2580365Protein Topoisomerase VI-B subunit [82778] (1 species)
    contains an H2TH domain inserted after this domain and before the second family-specific domain
  7. 2580366Species Sulfolobus shibatae [TaxId:2286] [82779] (7 PDB entries)
  8. 2580378Domain d1mx0c3: 1mx0 C:4-228 [79626]
    Other proteins in same PDB: d1mx0a1, d1mx0a2, d1mx0b1, d1mx0b2, d1mx0c1, d1mx0c2, d1mx0d1, d1mx0d2, d1mx0e1, d1mx0e2, d1mx0f1, d1mx0f2
    complexed with anp, mg, na

Details for d1mx0c3

PDB Entry: 1mx0 (more details), 2.3 Å

PDB Description: Structure of topoisomerase subunit
PDB Compounds: (C:) Type II DNA topoisomerase VI subunit B

SCOPe Domain Sequences for d1mx0c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mx0c3 d.122.1.2 (C:4-228) Topoisomerase VI-B subunit {Sulfolobus shibatae [TaxId: 2286]}
kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli
ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq
dkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpka
ksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqe

SCOPe Domain Coordinates for d1mx0c3:

Click to download the PDB-style file with coordinates for d1mx0c3.
(The format of our PDB-style files is described here.)

Timeline for d1mx0c3: