![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins) |
![]() | Protein Topoisomerase VI-B subunit [82778] (1 species) contains an H2TH domain inserted after this domain and before the second family-specific domain |
![]() | Species Sulfolobus shibatae [TaxId:2286] [82779] (7 PDB entries) |
![]() | Domain d1mx0b3: 1mx0 B:4-228 [79623] Other proteins in same PDB: d1mx0a1, d1mx0a2, d1mx0b1, d1mx0b2, d1mx0c1, d1mx0c2, d1mx0d1, d1mx0d2, d1mx0e1, d1mx0e2, d1mx0f1, d1mx0f2 complexed with anp, mg, na |
PDB Entry: 1mx0 (more details), 2.3 Å
SCOPe Domain Sequences for d1mx0b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mx0b3 d.122.1.2 (B:4-228) Topoisomerase VI-B subunit {Sulfolobus shibatae [TaxId: 2286]} kekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidli ddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhq dkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpka ksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqe
Timeline for d1mx0b3: