SCOP 1.65: Domain d1mx0b1: 1mx0 B:229-306

Lineage for d1mx0b1 (1mx0 B:229-306)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (3 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.3: Topoisomerase IV-B subunit middle domain [81705] (1 protein)

6. Protein Topoisomerase IV-B subunit middle domain [81706] (1 species)

7. Species Archaeon Sulfolobus shibatae [TaxId:2286] [81707] (2 PDB entries)

8. Domain d1mx0b1: 1mx0 B:229-306 [79621]
   Other proteins in same PDB: d1mx0a2, d1mx0a3, d1mx0b2, d1mx0b3, d1mx0c2, d1mx0c3, d1mx0d2, d1mx0d3, d1mx0e2, d1mx0e3, d1mx0f2, d1mx0f3

Details for d1mx0b1

PDB Entry: 1mx0, 2.3 Å

PDB Description: Structure of topoisomerase subunit

SCOP Domain Sequences for d1mx0b1:

Sequence; same for both SEQRES and ATOM records:

>d1mx0b1 a.156.1.3 (B:229-306) Topoisomerase IV-B subunit middle domain {Archaeon Sulfolobus shibatae}
vkphpygvdreeikilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknl
teeeitrlvetfkkyedf

Timeline for d1mx0b1:

• d1mx0b1 first appeared in SCOP 1.63
  
• d1mx0b1 appears in SCOP 1.67
  
• d1mx0b1 appears in the current release, SCOPe 2.08