Lineage for d1mwza_ (1mwz A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196856Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2196857Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2196950Protein Metal ion-transporting ATPase ZntA, N-terminal domain [82683] (1 species)
  7. 2196951Species Escherichia coli [TaxId:562] [82684] (2 PDB entries)
  8. 2196952Domain d1mwza_: 1mwz A: [79617]
    complexed with zn

Details for d1mwza_

PDB Entry: 1mwz (more details)

PDB Description: solution structure of the n-terminal domain of znta in the zn(ii)-form
PDB Compounds: (A:) ZntA

SCOPe Domain Sequences for d1mwza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]}
sgtryswkvsgmdcaacarkvenavrqlagvnqvqvlfateklvvdadndiraqvesalq
kagyslrdeqaae

SCOPe Domain Coordinates for d1mwza_:

Click to download the PDB-style file with coordinates for d1mwza_.
(The format of our PDB-style files is described here.)

Timeline for d1mwza_: