Lineage for d1mwub2 (1mwu B:139-327)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265029Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 265030Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (1 family) (S)
  5. 265031Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
  6. 265032Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
    contains inserted alpha+beta subdomain, residues 168-239
  7. 265033Species Staphylococcus aureus [TaxId:1280] [82825] (5 PDB entries)
  8. 265041Domain d1mwub2: 1mwu B:139-327 [79608]
    Other proteins in same PDB: d1mwua1, d1mwua3, d1mwub1, d1mwub3
    complexed with cd, cl, mc1; mutant

Details for d1mwub2

PDB Entry: 1mwu (more details), 2.6 Å

PDB Description: Structure of methicillin acyl-Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 2.60 A resolution.

SCOP Domain Sequences for d1mwub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwub2 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

SCOP Domain Coordinates for d1mwub2:

Click to download the PDB-style file with coordinates for d1mwub2.
(The format of our PDB-style files is described here.)

Timeline for d1mwub2: