| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily) unusual fold |
Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (1 family) ![]() |
| Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins) |
| Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species) contains inserted alpha+beta subdomain, residues 168-239 |
| Species Staphylococcus aureus [TaxId:1280] [82825] (5 PDB entries) |
| Domain d1mwub2: 1mwu B:139-327 [79608] Other proteins in same PDB: d1mwua1, d1mwua3, d1mwub1, d1mwub3 complexed with cd, cl, mc1; mutant |
PDB Entry: 1mwu (more details), 2.6 Å
SCOP Domain Sequences for d1mwub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwub2 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt
Timeline for d1mwub2: