Lineage for d1mwub2 (1mwu B:139-327)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004489Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 3004490Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 3004491Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
    contains an insert subdomain of ClpS-like fold
  6. 3004492Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
    the insert subdomain (residues 168-239) is fully ordered
  7. 3004493Species Staphylococcus aureus [TaxId:1280] [82825] (10 PDB entries)
    Uniprot O54286 27-668
  8. 3004509Domain d1mwub2: 1mwu B:139-327 [79608]
    Other proteins in same PDB: d1mwua1, d1mwua3, d1mwub1, d1mwub3
    complexed with 7ep, cd, cl
    has additional subdomain(s) that are not in the common domain

Details for d1mwub2

PDB Entry: 1mwu (more details), 2.6 Å

PDB Description: Structure of methicillin acyl-Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 2.60 A resolution.
PDB Compounds: (B:) penicillin-binding protein 2a

SCOPe Domain Sequences for d1mwub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwub2 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

SCOPe Domain Coordinates for d1mwub2:

Click to download the PDB-style file with coordinates for d1mwub2.
(The format of our PDB-style files is described here.)

Timeline for d1mwub2: