| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein) some sequence similarity to KSI automatically mapped to Pfam PF05223 |
| Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [82597] (6 PDB entries) Uniprot O54286 27-668 |
| Domain d1mwub1: 1mwu B:27-138 [79607] Other proteins in same PDB: d1mwua2, d1mwua3, d1mwub2, d1mwub3 complexed with 7ep, cd, cl |
PDB Entry: 1mwu (more details), 2.6 Å
SCOPe Domain Sequences for d1mwub1:
Sequence, based on SEQRES records: (download)
>d1mwub1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
>d1mwub1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
Timeline for d1mwub1: