Lineage for d1mwua3 (1mwu A:328-668)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013479Protein Penicillin binding protein 2a (PBP2A), C-terminal domain [82838] (1 species)
  7. 3013480Species Staphylococcus aureus [TaxId:1280] [82839] (10 PDB entries)
    Uniprot O54286 27-668
  8. 3013495Domain d1mwua3: 1mwu A:328-668 [79606]
    Other proteins in same PDB: d1mwua1, d1mwua2, d1mwub1, d1mwub2
    complexed with 7ep, cd, cl

Details for d1mwua3

PDB Entry: 1mwu (more details), 2.6 Å

PDB Description: Structure of methicillin acyl-Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 2.60 A resolution.
PDB Compounds: (A:) penicillin-binding protein 2a

SCOPe Domain Sequences for d1mwua3:

Sequence, based on SEQRES records: (download)

>d1mwua3 e.3.1.1 (A:328-668) Penicillin binding protein 2a (PBP2A), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpnm
mmainvkdvqdkgmasynakisgkvydelyengnkkydide

Sequence, based on observed residues (ATOM records): (download)

>d1mwua3 e.3.1.1 (A:328-668) Penicillin binding protein 2a (PBP2A), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnnl
dneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniiskeni
nlltdgmqqvvnkthkediyrsyanligksgtaelqigwfisydkdnpnmmmainvkdvq
dkgmasynakisgkvydelyengnkkydide

SCOPe Domain Coordinates for d1mwua3:

Click to download the PDB-style file with coordinates for d1mwua3.
(The format of our PDB-style files is described here.)

Timeline for d1mwua3: