Lineage for d1mwua2 (1mwu A:139-327)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684037Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 1684038Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 1684039Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
    contains an insert subdomain of ClpS-like fold
  6. 1684040Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
    the insert subdomain (residues 168-239) is fully ordered
  7. 1684041Species Staphylococcus aureus [TaxId:1280] [82825] (6 PDB entries)
    Uniprot O54286 27-668
  8. 1684050Domain d1mwua2: 1mwu A:139-327 [79605]
    Other proteins in same PDB: d1mwua1, d1mwua3, d1mwub1, d1mwub3
    complexed with 7ep, cd, cl

Details for d1mwua2

PDB Entry: 1mwu (more details), 2.6 Å

PDB Description: Structure of methicillin acyl-Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 2.60 A resolution.
PDB Compounds: (A:) penicillin-binding protein 2a

SCOPe Domain Sequences for d1mwua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwua2 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

SCOPe Domain Coordinates for d1mwua2:

Click to download the PDB-style file with coordinates for d1mwua2.
(The format of our PDB-style files is described here.)

Timeline for d1mwua2: