Lineage for d1mwua1 (1mwu A:27-138)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640820Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1641206Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
    some sequence similarity to KSI
    automatically mapped to Pfam PF05223
  6. 1641207Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)
  7. 1641208Species Staphylococcus aureus [TaxId:1280] [82597] (6 PDB entries)
    Uniprot O54286 27-668
  8. 1641217Domain d1mwua1: 1mwu A:27-138 [79604]
    Other proteins in same PDB: d1mwua2, d1mwua3, d1mwub2, d1mwub3
    complexed with 7ep, cd, cl

Details for d1mwua1

PDB Entry: 1mwu (more details), 2.6 Å

PDB Description: Structure of methicillin acyl-Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 2.60 A resolution.
PDB Compounds: (A:) penicillin-binding protein 2a

SCOPe Domain Sequences for d1mwua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwua1 d.17.4.5 (A:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOPe Domain Coordinates for d1mwua1:

Click to download the PDB-style file with coordinates for d1mwua1.
(The format of our PDB-style files is described here.)

Timeline for d1mwua1: