Lineage for d1mwtb2 (1mwt B:139-327)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337367Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 337368Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (1 family) (S)
  5. 337369Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
  6. 337370Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
    contains inserted alpha+beta subdomain, residues 168-239
  7. 337371Species Staphylococcus aureus [TaxId:1280] [82825] (5 PDB entries)
  8. 337377Domain d1mwtb2: 1mwt B:139-327 [79602]
    Other proteins in same PDB: d1mwta1, d1mwta3, d1mwtb1, d1mwtb3
    complexed with cd, cl, pg1; mutant

Details for d1mwtb2

PDB Entry: 1mwt (more details), 2.45 Å

PDB Description: structure of penicillin g acyl-penicillin binding protein 2a from methicillin resistant staphylococcus aureus strain 27r at 2.45 a resolution.

SCOP Domain Sequences for d1mwtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwtb2 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

SCOP Domain Coordinates for d1mwtb2:

Click to download the PDB-style file with coordinates for d1mwtb2.
(The format of our PDB-style files is described here.)

Timeline for d1mwtb2: