![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (10 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein) some sequence similarity to KSI |
![]() | Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [82597] (5 PDB entries) |
![]() | Domain d1mwtb1: 1mwt B:27-138 [79601] Other proteins in same PDB: d1mwta2, d1mwta3, d1mwtb2, d1mwtb3 complexed with cd, cl, pg1; mutant |
PDB Entry: 1mwt (more details), 2.45 Å
SCOP Domain Sequences for d1mwtb1:
Sequence, based on SEQRES records: (download)
>d1mwtb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus} dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
>d1mwtb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus} dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik kkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
Timeline for d1mwtb1: