Lineage for d1mwtb1 (1mwt B:27-138)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326290Fold d.17: Cystatin-like [54402] (6 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 326465Superfamily d.17.4: NTF2-like [54427] (8 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 326590Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
    some sequence similarity to KSI
  6. 326591Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)
  7. 326592Species Staphylococcus aureus [TaxId:1280] [82597] (5 PDB entries)
  8. 326598Domain d1mwtb1: 1mwt B:27-138 [79601]
    Other proteins in same PDB: d1mwta2, d1mwta3, d1mwtb2, d1mwtb3
    complexed with cd, cl, pg1; mutant

Details for d1mwtb1

PDB Entry: 1mwt (more details), 2.45 Å

PDB Description: structure of penicillin g acyl-penicillin binding protein 2a from methicillin resistant staphylococcus aureus strain 27r at 2.45 a resolution.

SCOP Domain Sequences for d1mwtb1:

Sequence, based on SEQRES records: (download)

>d1mwtb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Sequence, based on observed residues (ATOM records): (download)

>d1mwtb1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOP Domain Coordinates for d1mwtb1:

Click to download the PDB-style file with coordinates for d1mwtb1.
(The format of our PDB-style files is described here.)

Timeline for d1mwtb1: