SCOPe 2.07: Domain d1mwta2: 1mwt A:139-327

Lineage for d1mwta2 (1mwt A:139-327)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
   contains an insert subdomain of ClpS-like fold

6. Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
   the insert subdomain (residues 168-239) is fully ordered

7. Species Staphylococcus aureus [TaxId:1280] [82825] (10 PDB entries)
   Uniprot O54286 27-668

8. Domain d1mwta2: 1mwt A:139-327 [79599]
   Other proteins in same PDB: d1mwta1, d1mwta3, d1mwtb1, d1mwtb3
   complexed with cd, cl

Details for d1mwta2

PDB Entry: 1mwt, 2.45 Å

PDB Description: structure of penicillin g acyl-penicillin binding protein 2a from methicillin resistant staphylococcus aureus strain 27r at 2.45 a resolution.

PDB Compounds: (A:) penicillin-binding protein 2a

SCOPe Domain Sequences for d1mwta2:

Sequence; same for both SEQRES and ATOM records:

>d1mwta2 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Timeline for d1mwta2:

• d1mwta2 first appeared in SCOP 1.63
  
• d1mwta2 appears in SCOPe 2.06
  
• d1mwta2 appears in the current release, SCOPe 2.08