SCOP 1.65: Domain d1mwta2: 1mwt A:139-327

Lineage for d1mwta2 (1mwt A:139-327)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (1 family)

5. Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)

6. Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
   contains inserted alpha+beta subdomain, residues 168-239

7. Species Staphylococcus aureus [TaxId:1280] [82825] (5 PDB entries)

8. Domain d1mwta2: 1mwt A:139-327 [79599]
   Other proteins in same PDB: d1mwta1, d1mwta3, d1mwtb1, d1mwtb3

Details for d1mwta2

PDB Entry: 1mwt, 2.45 Å

PDB Description: structure of penicillin g acyl-penicillin binding protein 2a from methicillin resistant staphylococcus aureus strain 27r at 2.45 a resolution.

SCOP Domain Sequences for d1mwta2:

Sequence; same for both SEQRES and ATOM records:

>d1mwta2 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Timeline for d1mwta2:

• d1mwta2 first appeared in SCOP 1.63
  
• d1mwta2 appears in SCOP 1.67
  
• d1mwta2 appears in the current release, SCOPe 2.08