Lineage for d1mwta1 (1mwt A:27-138)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896592Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
    some sequence similarity to KSI
    automatically mapped to Pfam PF05223
  6. 1896593Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)
  7. 1896594Species Staphylococcus aureus [TaxId:1280] [82597] (6 PDB entries)
    Uniprot O54286 27-668
  8. 1896599Domain d1mwta1: 1mwt A:27-138 [79598]
    Other proteins in same PDB: d1mwta2, d1mwta3, d1mwtb2, d1mwtb3
    complexed with cd, cl

Details for d1mwta1

PDB Entry: 1mwt (more details), 2.45 Å

PDB Description: structure of penicillin g acyl-penicillin binding protein 2a from methicillin resistant staphylococcus aureus strain 27r at 2.45 a resolution.
PDB Compounds: (A:) penicillin-binding protein 2a

SCOPe Domain Sequences for d1mwta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwta1 d.17.4.5 (A:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOPe Domain Coordinates for d1mwta1:

Click to download the PDB-style file with coordinates for d1mwta1.
(The format of our PDB-style files is described here.)

Timeline for d1mwta1: