Lineage for d1mwrb2 (1mwr B:139-327)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004489Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 3004490Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 3004491Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
    contains an insert subdomain of ClpS-like fold
  6. 3004492Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
    the insert subdomain (residues 168-239) is fully ordered
  7. 3004493Species Staphylococcus aureus [TaxId:1280] [82825] (10 PDB entries)
    Uniprot O54286 27-668
  8. 3004511Domain d1mwrb2: 1mwr B:139-327 [79590]
    Other proteins in same PDB: d1mwra1, d1mwra3, d1mwrb1, d1mwrb3
    complexed with cd, cl
    has additional subdomain(s) that are not in the common domain

Details for d1mwrb2

PDB Entry: 1mwr (more details), 2.45 Å

PDB Description: Structure of SeMet Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r (trigonal form) at 2.45 A resolution.
PDB Compounds: (B:) penicillin-binding protein 2a

SCOPe Domain Sequences for d1mwrb2:

Sequence, based on SEQRES records: (download)

>d1mwrb2 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Sequence, based on observed residues (ATOM records): (download)

>d1mwrb2 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddsntiahtliekkkk
dgkdiqlt

SCOPe Domain Coordinates for d1mwrb2:

Click to download the PDB-style file with coordinates for d1mwrb2.
(The format of our PDB-style files is described here.)

Timeline for d1mwrb2: