Lineage for d1mwnb_ (1mwn B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213167Superfamily a.39.1: EF-hand [47473] (9 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 213190Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 213191Protein Calcyclin (S100) [47479] (15 species)
  7. 213267Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (5 PDB entries)
  8. 213271Domain d1mwnb_: 1mwn B: [79585]
    complex with high-affinity target peptide trtk-12, chains X and Y
    complexed with ca

Details for d1mwnb_

PDB Entry: 1mwn (more details)

PDB Description: solution nmr structure of s100b bound to the high-affinity target peptide trtk-12

SCOP Domain Sequences for d1mwnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwnb_ a.39.1.2 (B:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dedgdgecdfqefmafvsmvttacheffehe

SCOP Domain Coordinates for d1mwnb_:

Click to download the PDB-style file with coordinates for d1mwnb_.
(The format of our PDB-style files is described here.)

Timeline for d1mwnb_: