SCOPe 2.07: Domain d1mwna_: 1mwn A:

Lineage for d1mwna_ (1mwn A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Norway rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (7 PDB entries)

8. Domain d1mwna_: 1mwn A: [79584]
   complex with high-affinity target peptide trtk-12, chains X and Y
   complexed with ca

Details for d1mwna_

PDB Entry: 1mwn

PDB Description: solution nmr structure of s100b bound to the high-affinity target peptide trtk-12

PDB Compounds: (A:) S-100 protein, beta chain

SCOPe Domain Sequences for d1mwna_:

Sequence; same for both SEQRES and ATOM records:

>d1mwna_ a.39.1.2 (A:) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100b [TaxId: 10116]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dedgdgecdfqefmafvsmvttacheffehe

Timeline for d1mwna_:

• d1mwna_ first appeared in SCOP 1.63
  
• d1mwna_ appears in SCOPe 2.06
  
• d1mwna_ appears in the current release, SCOPe 2.08