Lineage for d1mwna_ (1mwn A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280804Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 280805Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 280828Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 280829Protein Calcyclin (S100) [47479] (16 species)
  7. 280914Species Rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (5 PDB entries)
  8. 280917Domain d1mwna_: 1mwn A: [79584]

Details for d1mwna_

PDB Entry: 1mwn (more details)

PDB Description: solution nmr structure of s100b bound to the high-affinity target peptide trtk-12

SCOP Domain Sequences for d1mwna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwna_ a.39.1.2 (A:) Calcyclin (S100) {Rat (Rattus norvegicus), s100b}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dedgdgecdfqefmafvsmvttacheffehe

SCOP Domain Coordinates for d1mwna_:

Click to download the PDB-style file with coordinates for d1mwna_.
(The format of our PDB-style files is described here.)

Timeline for d1mwna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mwnb_