SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1mwna_ (1mwn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994353Family a.39.1.2: S100 proteins [47478] (2 protein domains)
    dimer: subunits are made of two EF-hands
  6. 1994354Protein Calcyclin (S100) [47479] (17 species)
  7. 1994542Species Norway rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (7 PDB entries)
  8. 1994547Domain d1mwna_: 1mwn A: [79584]
    complex with high-affinity target peptide trtk-12, chains X and Y
    complexed with ca

Details for d1mwna_

PDB Entry: 1mwn (more details)

PDB Description: Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12
PDB Compounds: (A:) S-100 protein, beta chain

SCOPe Domain Sequences for d1mwna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwna_ a.39.1.2 (A:) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100b [TaxId: 10116]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dedgdgecdfqefmafvsmvttacheffehe

SCOPe Domain Coordinates for d1mwna_:

Click to download the PDB-style file with coordinates for d1mwna_.
(The format of our PDB-style files is described here.)

Timeline for d1mwna_: