Lineage for d1mwna_ (1mwn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994353Family a.39.1.2: S100 proteins [47478] (2 protein domains)
    dimer: subunits are made of two EF-hands
  6. 1994354Protein Calcyclin (S100) [47479] (17 species)
  7. 1994542Species Norway rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (7 PDB entries)
  8. 1994547Domain d1mwna_: 1mwn A: [79584]
    complex with high-affinity target peptide trtk-12, chains X and Y
    complexed with ca

Details for d1mwna_

PDB Entry: 1mwn (more details)

PDB Description: Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12
PDB Compounds: (A:) S-100 protein, beta chain

SCOPe Domain Sequences for d1mwna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwna_ a.39.1.2 (A:) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100b [TaxId: 10116]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dedgdgecdfqefmafvsmvttacheffehe

SCOPe Domain Coordinates for d1mwna_:

Click to download the PDB-style file with coordinates for d1mwna_.
(The format of our PDB-style files is described here.)

Timeline for d1mwna_: