Lineage for d1mwmb2 (1mwm B:158-320)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397315Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 397316Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 397317Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 397464Protein Plasmid segregation protein ParM [82438] (1 species)
  7. 397465Species Escherichia coli [TaxId:562] [82439] (2 PDB entries)
  8. 397469Domain d1mwmb2: 1mwm B:158-320 [79583]
    complexed with adp, mg

Details for d1mwmb2

PDB Entry: 1mwm (more details), 2 Å

PDB Description: parm from plasmid r1 adp form

SCOP Domain Sequences for d1mwmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwmb2 c.55.1.1 (B:158-320) Plasmid segregation protein ParM {Escherichia coli}
qeldeldslliidlggttldisqvmgklsgiskiygdsslgvslvtsavkdalslartkg
ssyladdiiihrkdnnylkqrindenkisivteamnealrkleqrvlntlnefsgythvm
vigggaelicdavkkhtqirderffktnnsqydlvngmylign

SCOP Domain Coordinates for d1mwmb2:

Click to download the PDB-style file with coordinates for d1mwmb2.
(The format of our PDB-style files is described here.)

Timeline for d1mwmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mwmb1