Lineage for d1mwkb1 (1mwk B:1-157)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372695Protein Plasmid segregation protein ParM [82438] (1 species)
  7. 1372696Species Escherichia coli [TaxId:562] [82439] (6 PDB entries)
  8. 1372711Domain d1mwkb1: 1mwk B:1-157 [79578]

Details for d1mwkb1

PDB Entry: 1mwk (more details), 2.3 Å

PDB Description: ParM from plasmid R1 APO form
PDB Compounds: (B:) ParM

SCOPe Domain Sequences for d1mwkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwkb1 c.55.1.1 (B:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
rkkanfrkkitlnggdtftikdvkvmpesipagyevl

SCOPe Domain Coordinates for d1mwkb1:

Click to download the PDB-style file with coordinates for d1mwkb1.
(The format of our PDB-style files is described here.)

Timeline for d1mwkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mwkb2