SCOP 1.73: Domain d1mwkb1: 1mwk B:1-157

Lineage for d1mwkb1 (1mwk B:1-157)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Plasmid segregation protein ParM [82438] (1 species)

7. Species Escherichia coli [TaxId:562] [82439] (2 PDB entries)

8. Domain d1mwkb1: 1mwk B:1-157 [79578]

Details for d1mwkb1

PDB Entry: 1mwk, 2.3 Å

PDB Description: ParM from plasmid R1 APO form

PDB Compounds: (B:) ParM

SCOP Domain Sequences for d1mwkb1:

Sequence; same for both SEQRES and ATOM records:

>d1mwkb1 c.55.1.1 (B:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
rkkanfrkkitlnggdtftikdvkvmpesipagyevl

Timeline for d1mwkb1:

• d1mwkb1 first appeared in SCOP 1.63
  
• d1mwkb1 appears in SCOP 1.71
  
• d1mwkb1 appears in SCOP 1.75
  
• d1mwkb1 appears in the current release, SCOPe 2.08