Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
Protein Plasmid segregation protein ParM [82438] (1 species) |
Species Escherichia coli [TaxId:562] [82439] (2 PDB entries) |
Domain d1mwka2: 1mwk A:158-320 [79577] |
PDB Entry: 1mwk (more details), 2.3 Å
SCOP Domain Sequences for d1mwka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwka2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} qeldeldslliidlggttldisqvmgklsgiskiygdsslgvslvtsavkdalslartkg ssyladdiiihrkdnnylkqrindenkisivteamnealrkleqrvlntlnefsgythvm vigggaelicdavkkhtqirderffktnnsqydlvngmylign
Timeline for d1mwka2: