Lineage for d1mwka2 (1mwk A:158-320)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701286Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 701519Protein Plasmid segregation protein ParM [82438] (1 species)
  7. 701520Species Escherichia coli [TaxId:562] [82439] (2 PDB entries)
  8. 701526Domain d1mwka2: 1mwk A:158-320 [79577]

Details for d1mwka2

PDB Entry: 1mwk (more details), 2.3 Å

PDB Description: ParM from plasmid R1 APO form
PDB Compounds: (A:) ParM

SCOP Domain Sequences for d1mwka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwka2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
qeldeldslliidlggttldisqvmgklsgiskiygdsslgvslvtsavkdalslartkg
ssyladdiiihrkdnnylkqrindenkisivteamnealrkleqrvlntlnefsgythvm
vigggaelicdavkkhtqirderffktnnsqydlvngmylign

SCOP Domain Coordinates for d1mwka2:

Click to download the PDB-style file with coordinates for d1mwka2.
(The format of our PDB-style files is described here.)

Timeline for d1mwka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mwka1