Lineage for d1mwja_ (1mwj A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114317Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2114318Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2114393Family c.18.1.2: Mug-like [52147] (3 proteins)
  6. 2114398Protein G:T/U mismatch-specific DNA glycosylase, Mug [52148] (1 species)
  7. 2114399Species Escherichia coli [TaxId:562] [52149] (4 PDB entries)
  8. 2114402Domain d1mwja_: 1mwj A: [79575]
    DNA pseudo substrate complex
    protein/DNA complex

Details for d1mwja_

PDB Entry: 1mwj (more details), 2.85 Å

PDB Description: crystal structure of a mug-dna pseudo substrate complex
PDB Compounds: (A:) G/U mismatch-specific DNA glycosylase

SCOPe Domain Sequences for d1mwja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwja_ c.18.1.2 (A:) G:T/U mismatch-specific DNA glycosylase, Mug {Escherichia coli [TaxId: 562]}
mvedilapglrvvfcginpglssagtgfpfahpanrfwkviyqagftdrqlkpqeaqhll
dyrcgvtklvdrptvqanevskqelhaggrkliekiedyqpqalailgkqayeqgfsqrg
aqwgkqtltigstqiwvlpnpsglsrvsleklveayreldqalvv

SCOPe Domain Coordinates for d1mwja_:

Click to download the PDB-style file with coordinates for d1mwja_.
(The format of our PDB-style files is described here.)

Timeline for d1mwja_: