Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.18: DNA glycosylase [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: DNA glycosylase [52141] (3 families) |
Family c.18.1.2: Mug-like [52147] (2 proteins) |
Protein G:T/U mismatch-specific DNA glycosylase, Mug [52148] (1 species) |
Species Escherichia coli [TaxId:562] [52149] (4 PDB entries) |
Domain d1mwja_: 1mwj A: [79575] DNA pseudo substrate complex complexed with du |
PDB Entry: 1mwj (more details), 2.85 Å
SCOP Domain Sequences for d1mwja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwja_ c.18.1.2 (A:) G:T/U mismatch-specific DNA glycosylase, Mug {Escherichia coli} mvedilapglrvvfcginpglssagtgfpfahpanrfwkviyqagftdrqlkpqeaqhll dyrcgvtklvdrptvqanevskqelhaggrkliekiedyqpqalailgkqayeqgfsqrg aqwgkqtltigstqiwvlpnpsglsrvsleklveayreldqalvv
Timeline for d1mwja_: