Lineage for d1mwia_ (1mwi A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691382Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 691383Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (3 families) (S)
  5. 691427Family c.18.1.2: Mug-like [52147] (2 proteins)
  6. 691428Protein G:T/U mismatch-specific DNA glycosylase, Mug [52148] (1 species)
  7. 691429Species Escherichia coli [TaxId:562] [52149] (4 PDB entries)
  8. 691431Domain d1mwia_: 1mwi A: [79574]
    DNA product complex
    complexed with d1p

Details for d1mwia_

PDB Entry: 1mwi (more details), 2.35 Å

PDB Description: Crystal structure of a MUG-DNA product complex
PDB Compounds: (A:) G/U mismatch-specific DNA glycosylase

SCOP Domain Sequences for d1mwia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwia_ c.18.1.2 (A:) G:T/U mismatch-specific DNA glycosylase, Mug {Escherichia coli [TaxId: 562]}
mvedilapglrvvfcginpglssagtgfpfahpanrfwkviyqagftdrqlkpqeaqhll
dyrcgvtklvdrptvqanevskqelhaggrkliekiedyqpqalailgkqayeqgfsqrg
aqwgkqtltigstqiwvlpnpsglsrvsleklveayreldqalvv

SCOP Domain Coordinates for d1mwia_:

Click to download the PDB-style file with coordinates for d1mwia_.
(The format of our PDB-style files is described here.)

Timeline for d1mwia_: