SCOPe 2.05: Domain d1mwba_: 1mwb A:

Lineage for d1mwba_ (1mwb A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
   lack the first helix (A)

6. Protein Protozoan/bacterial hemoglobin [46460] (6 species)

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [81667] (7 PDB entries)
   Uniprot P73925

8. Domain d1mwba_: 1mwb A: [79572]
   complexed with hem

Details for d1mwba_

PDB Entry: 1mwb

PDB Description: Solution structure of the recombinant hemoglobin from the cyanobacterium Synechocystis sp. PCC 6803 in its hemichrome state

PDB Compounds: (A:) Cyanoglobin

SCOPe Domain Sequences for d1mwba_:

Sequence; same for both SEQRES and ATOM records:

>d1mwba_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Synechocystis sp. PCC 6803 [TaxId: 1148]}
stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
lnq

Timeline for d1mwba_:

• d1mwba_ first appeared in SCOP 1.63
  
• d1mwba_ appears in SCOPe 2.04
  
• d1mwba_ appears in SCOPe 2.06
  
• d1mwba_ appears in the current release, SCOPe 2.08