Lineage for d1mwba_ (1mwb A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436028Family a.1.1.1: Truncated hemoglobin [46459] (1 protein)
    lack the first helix (A)
  6. 436029Protein Protozoan/bacterial hemoglobin [46460] (5 species)
  7. 436033Species Cyanobacteria (Synechocystis sp.), pcc 6803 [TaxId:1148] [81667] (4 PDB entries)
  8. 436037Domain d1mwba_: 1mwb A: [79572]

Details for d1mwba_

PDB Entry: 1mwb (more details)

PDB Description: Solution structure of the recombinant hemoglobin from the cyanobacterium Synechocystis sp. PCC 6803 in its hemichrome state

SCOP Domain Sequences for d1mwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwba_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Cyanobacteria (Synechocystis sp.), pcc 6803}
stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
lnq

SCOP Domain Coordinates for d1mwba_:

Click to download the PDB-style file with coordinates for d1mwba_.
(The format of our PDB-style files is described here.)

Timeline for d1mwba_: