Lineage for d1mwam_ (1mwa M:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1105903Protein beta2-microglobulin [88600] (5 species)
  7. 1106406Species Mouse (Mus musculus) [TaxId:10090] [88603] (150 PDB entries)
    Uniprot P01887
  8. 1106623Domain d1mwam_: 1mwa M: [79571]
    Other proteins in same PDB: d1mwaa1, d1mwaa2, d1mwab1, d1mwab2, d1mwac1, d1mwac2, d1mwad1, d1mwad2, d1mwah1, d1mwah2, d1mwai1, d1mwai2
    complexed with acy, gol, nag

Details for d1mwam_

PDB Entry: 1mwa (more details), 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex
PDB Compounds: (M:) microglobulin MHC light chain

SCOPe Domain Sequences for d1mwam_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwam_ b.1.1.2 (M:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1mwam_:

Click to download the PDB-style file with coordinates for d1mwam_.
(The format of our PDB-style files is described here.)

Timeline for d1mwam_: