Lineage for d1mwam_ (1mwa M:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288544Protein beta2-microglobulin [88600] (4 species)
  7. 288646Species Mouse (Mus musculus) [TaxId:10090] [88603] (48 PDB entries)
  8. 288705Domain d1mwam_: 1mwa M: [79571]
    Other proteins in same PDB: d1mwaa1, d1mwaa2, d1mwab1, d1mwab2, d1mwac1, d1mwac2, d1mwad1, d1mwad2, d1mwah1, d1mwah2, d1mwai1, d1mwai2
    complexed with acy, gol, man, nag

Details for d1mwam_

PDB Entry: 1mwa (more details), 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex

SCOP Domain Sequences for d1mwam_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwam_ b.1.1.2 (M:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1mwam_:

Click to download the PDB-style file with coordinates for d1mwam_.
(The format of our PDB-style files is described here.)

Timeline for d1mwam_: