SCOPe 2.01: Domain d1mwai1: 1mwa I:182-274

Lineage for d1mwai1 (1mwa I:182-274)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
   Uniprot P01901 22-299

8. Domain d1mwai1: 1mwa I:182-274 [79568]
   Other proteins in same PDB: d1mwaa1, d1mwaa2, d1mwab1, d1mwab2, d1mwac1, d1mwac2, d1mwad1, d1mwad2, d1mwah2, d1mwai2, d1mwal_, d1mwam_
   complexed with acy, gol, nag

Details for d1mwai1

PDB Entry: 1mwa, 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex

PDB Compounds: (I:) h-2kbm3 MHC class I molecule heavy chain

SCOPe Domain Sequences for d1mwai1:

Sequence; same for both SEQRES and ATOM records:

>d1mwai1 b.1.1.2 (I:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

Timeline for d1mwai1:

• d1mwai1 first appeared in SCOP 1.63
  
• d1mwai1 appears in SCOP 1.75
  
• d1mwai1 appears in SCOPe 2.02
  
• d1mwai1 appears in the current release, SCOPe 2.08