Lineage for d1mwai1 (1mwa I:182-274)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220417Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 220647Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (23 PDB entries)
  8. 220695Domain d1mwai1: 1mwa I:182-274 [79568]
    Other proteins in same PDB: d1mwaa1, d1mwaa2, d1mwab1, d1mwab2, d1mwac1, d1mwac2, d1mwad1, d1mwad2, d1mwah2, d1mwai2
    complexed with acy, gol, man, nag

Details for d1mwai1

PDB Entry: 1mwa (more details), 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex

SCOP Domain Sequences for d1mwai1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwai1 b.1.1.2 (I:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOP Domain Coordinates for d1mwai1:

Click to download the PDB-style file with coordinates for d1mwai1.
(The format of our PDB-style files is described here.)

Timeline for d1mwai1: