Lineage for d1mwah2 (1mwa H:1-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600422Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
  8. 600467Domain d1mwah2: 1mwa H:1-181 [79567]
    Other proteins in same PDB: d1mwaa1, d1mwaa2, d1mwab1, d1mwab2, d1mwac1, d1mwac2, d1mwad1, d1mwad2, d1mwah1, d1mwai1, d1mwal_, d1mwam_

Details for d1mwah2

PDB Entry: 1mwa (more details), 2.4 Å

PDB Description: 2c/h-2kbm3/dev8 allogeneic complex

SCOP Domain Sequences for d1mwah2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwah2 d.19.1.1 (H:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvslrtllgyynqsaggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d1mwah2:

Click to download the PDB-style file with coordinates for d1mwah2.
(The format of our PDB-style files is described here.)

Timeline for d1mwah2: