Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries) |
Domain d1mwad2: 1mwa D:118-247 [79565] Other proteins in same PDB: d1mwaa1, d1mwab1, d1mwac1, d1mwad1, d1mwah1, d1mwah2, d1mwai1, d1mwai2, d1mwal_, d1mwam_ complexed with acy, gol, nag |
PDB Entry: 1mwa (more details), 2.4 Å
SCOPe Domain Sequences for d1mwad2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwad2 b.1.1.2 (D:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea wgradc
Timeline for d1mwad2: